SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7M3R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7M3R8
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily BEACH domain 2.62e-44
Family BEACH domain 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7M3R8
Sequence length 130
Comment (tr|A0A0S7M3R8|A0A0S7M3R8_9TELE) NBEA {ECO:0000313|EMBL:JAO96388.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=NBEA OC=Poeciliinae; Poeciliopsis.
Sequence
MFVNSNEYELGVRDDGVPVCDVELPVWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFG
YKQRGPEAVRALNVFNFLSYEGAVNLDNLDAAQREVIETQIQVSGQVPSQLLIEPHPPRS
SAMHLCFLPQ
Download sequence
Identical sequences A0A0S7M3R8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]