SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S9R9K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S9R9K5
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily Ribosomal protein L36 1.96e-17
Family Ribosomal protein L36 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S9R9K5
Sequence length 37
Comment (tr|A0A0S9R9K5|A0A0S9R9K5_9ACTN) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome; Reference proteome OX=1736324 OS=Aeromicrobium sp. Leaf289. GN=ASF37_09775 OC=Aeromicrobium.
Sequence
MKVNPSVKKICDKCKVIRRHGRVMVICENPRHKQRQG
Download sequence
Identical sequences A0A0A1DMR4 A0A0Q7QRF2 A0A0Q8PTX2 A0A0S9R9K5 A0A0U3T4K2 A0A1G9I9N6 A0A1J4MZZ2 A0A1M3LGP6 A0A1T4YWA8 A0A1V2NYG2 D2PU56 E9UY04
gi|284033975|ref|YP_003383906.1| WP_008361054.1.10660 WP_008361054.1.13192 WP_008361054.1.13659 WP_008361054.1.13800 WP_008361054.1.1627 WP_008361054.1.23471 WP_008361054.1.29489 WP_008361054.1.29652 WP_008361054.1.32755 WP_008361054.1.40379 WP_008361054.1.48845 WP_008361054.1.58245 WP_008361054.1.59300 WP_008361054.1.69711 WP_008361054.1.81058 WP_008361054.1.81682 WP_008361054.1.84249 WP_008361054.1.92033 WP_008361054.1.94924 WP_008361054.1.97121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]