SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T0MAG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T0MAG7
Domain Number 1 Region: 24-156
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.0000994
Family PsbP-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T0MAG7
Sequence length 158
Comment (tr|A0A0T0MAG7|A0A0T0MAG7_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:KQS93294.1} KW=Complete proteome; Reference proteome OX=1736361 OS=Chryseobacterium sp. Leaf394. GN=ASG21_06960 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MKKSFLIAAFLLSTFTFSQKLGTELYESENYSIKMPDLWKATNDEGIVNIFPTNQIGAIT
ISEYHGLDLPKEEVKKFILALYNSPEDEKKVKSTGNKKGYSEYQYDYLDEKENLYWVTKV
YQKNKDLYLISINCQQKHWNGNYKMLFSEAFESFKIKK
Download sequence
Identical sequences A0A0T0MAG7
WP_056082290.1.28015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]