SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T6UZ37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T6UZ37
Domain Number 1 Region: 3-58
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000000235
Family H-NS histone-like proteins 0.0014
Further Details:      
 
Domain Number 2 Region: 93-134
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000337
Family H-NS histone-like proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0T6UZ37
Sequence length 134
Comment (tr|A0A0T6UZ37|A0A0T6UZ37_9GAMM) DNA-binding protein {ECO:0000256|PIRNR:PIRNR002096} KW=Complete proteome OX=656 OS=Aeromonas allosaccharophila. GN=AO724_12525 OC=Aeromonadaceae; Aeromonas.
Sequence
MTEFLKVLLNIRSLRAALRELSFEQLQEANEKFTAIYNERATEIEKTRVADAERLAKLAE
FQAMLADAGIDPSELVQGAPASKAAREGAKRAPRPPKYKYMEDGQEKTWTGQGRTPKALA
TLLEQGHQLDEFLI
Download sequence
Identical sequences A0A0T6UZ37
WP_058052149.1.96344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]