SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T6VYQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T6VYQ9
Domain Number 1 Region: 14-255
Classification Level Classification E-value
Superfamily ThiG-like 2.09e-89
Family ThiG-like 0.00000000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0T6VYQ9
Sequence length 269
Comment (tr|A0A0T6VYQ9|A0A0T6VYQ9_9ALTE) Thiazole synthase {ECO:0000256|HAMAP-Rule:MF_00443, ECO:0000256|SAAS:SAAS00958550} KW=Complete proteome OX=1119533 OS=Marinobacter sp. P4B1. GN=AQ621_02445 OC=Alteromonadaceae; Marinobacter.
Sequence
MTDTPEIQLPEDKPLEIAGKVYQSRLLVGTGKYHDLMETGHAIEASGAEIVTVAVRRTNI
GQNPDEPNLLDVVSPDAYTILPNTAGCYTAKDAVRTCKLARELLDGHDLVKLEVLGEHKT
LYPNMPETLAAAEELIKDGFKVMVYCSDDPLLAMRLEEMGCVAIMPLGAPIGSGLGIQNR
YNIRLIVENAKVPVLVDAGVGTASDATIAMELGCDGVLMNTAIAQAKDPIKMANAMRLAI
EAGREAYLAGRMPKKLYASASSPIDGTFF
Download sequence
Identical sequences A0A0T6VYQ9 U7G937
WP_022988423.1.60909 WP_022988423.1.77737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]