SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T6XKP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T6XKP2
Domain Number 1 Region: 63-165
Classification Level Classification E-value
Superfamily NosL/MerB-like 4.45e-35
Family NosL-like 0.000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0T6XKP2
Sequence length 188
Comment (tr|A0A0T6XKP2|A0A0T6XKP2_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:KSV63154.1} KW=Complete proteome OX=1358416 OS=Sinorhizobium sp. GL2. GN=N182_37355 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MRRALVAAALLSAFLLASCKEEQKAPPPAPYALTSEATGRYCGMNVLEHPGPKGQIILDA
QVPEPIWFSSARDALAFTMLPEEPKDIAAIYVSDMSKAPSWEKPGENNWIDARKAFYVIG
SSLRGGMGAEEAVPFGTEEAAQQFSVKNGGRVVPFGEVPQDYVLGAGGVDATTTSPDAEE
SVEGHNHG
Download sequence
Identical sequences A0A0T6XKP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]