SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T8ZN44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T8ZN44
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Hypothetical protein YhaI 4.45e-41
Family Hypothetical protein YhaI 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0T8ZN44
Sequence length 92
Comment (tr|A0A0T8ZN44|A0A0T8ZN44_STREE) Protein of uncharacterized function (DUF1878) {ECO:0000313|EMBL:CKI01421.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS232498_06838 OC=Streptococcus.
Sequence
MIDEEKCPFYSLIIKKKARKKDVERILHLCEKLNEQYVAEKAEGLLLFDALLDQFEKALP
HQLEVHETAEALAKQGLFKPLMNEFLSMIAKK
Download sequence
Identical sequences A0A0T8ZN44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]