SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T9RQP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0T9RQP7
Domain Number - Region: 99-173
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.000994
Family PA0094-like 0.034
Further Details:      
 
Domain Number - Region: 59-116
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00619
Family alpha-Amylases, C-terminal beta-sheet domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T9RQP7
Sequence length 174
Comment (tr|A0A0T9RQP7|A0A0T9RQP7_YERBE) Dcrb protein {ECO:0000313|EMBL:CNI77651.1} KW=Complete proteome OX=634 OS=Yersinia bercovieri. GN=ERS008506_03081 OC=Yersiniaceae; Yersinia.
Sequence
MHKITKFLAVGLLVVGLSACDSGNDKNVGQAVSLLEGKVTLSLPADLSDQSGKMGNQANN
MSVFANKTGDKAVIVILGDNTNEALEVLTGRLADQQRARDANLQVVTNKAIKIDGQPFQQ
LDSIITSGGQKAYSSVLMGRVDNHLMTLQITLPAENQQQAQAEAESIISTLKLK
Download sequence
Identical sequences A0A0T7NW56 A0A0T9RQP7
WP_005274852.1.47260 WP_005274852.1.85719 WP_005274852.1.92017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]