SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U1HAX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U1HAX5
Domain Number 1 Region: 15-140
Classification Level Classification E-value
Superfamily FlgN-like 3.14e-23
Family FlgN-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U1HAX5
Sequence length 151
Comment (tr|A0A0U1HAX5|A0A0U1HAX5_YEREN) Lateral flagellar chaperone protein {ECO:0000313|EMBL:CQH29664.1} KW=Complete proteome OX=630 OS=Yersinia enterocolitica. GN=ERS008580_01234 OC=Yersiniaceae; Yersinia.
Sequence
MESVNTVPQQNSKQEHVKQLLVAIQEDRKRYIALEKLLVKQRELMIKHDSEALQTLNPQL
MELYNLIDKTASERRMLMQELQLPAHKEGMHLLLSQLPAHYREHAGALWADLRLRADACR
QQNHHNGMLLTMQMDLLSSLTKTQSDFLYVG
Download sequence
Identical sequences A0A0U1HAX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]