SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U1M6L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U1M6L3
Domain Number 1 Region: 96-236
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-48
Family Ran-binding domain 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U1M6L3
Sequence length 242
Comment (tr|A0A0U1M6L3|A0A0U1M6L3_TALIS) Ran-specific GTPase-activating protein 1 {ECO:0000313|EMBL:CRG90680.1} KW=Complete proteome; Reference proteome OX=28573 OS=Talaromyces islandicus (Penicillium islandicum). GN=PISL3812_07725 OC=Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces.
Sequence
MSDATETKPDPASTTAAEEATTAPAVDKTAEEDKSVTEKAADAADSAATKASDNVFSMFG
GGPKKEKKEEADDADEPSGSSKAKKEEGEEEEVESPDVHFEPVIHLTEKVDTKTNEELEE
QTFKMRAKLFKFDRESREWKERGTGDVRLLKHKENQKTRLVMRRDKTLKVCANHYIVPDM
KLSPNVGSDRSWVWNAAADVSEGEPEAQTLAIRFANSENANLFKEAFEKAQQENEKLFSQ
EA
Download sequence
Identical sequences A0A0U1M6L3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]