SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U1ME69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0U1ME69
Domain Number - Region: 12-45
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.0837
Family DP dimerization segment 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0U1ME69
Sequence length 64
Comment (tr|A0A0U1ME69|A0A0U1ME69_STAAU) Uncharacterized protein {ECO:0000313|EMBL:CRI07672.1} KW=Complete proteome OX=1280 OS=Staphylococcus aureus. GN=BN1321_110002 OC=Staphylococcus.
Sequence
MYIAQAKCPSNLNALSFLLSKNTSHSKANKKGKHSNFEYLPFLYIVFNINIYGGGRGIRT
PASR
Download sequence
Identical sequences A0A0U1ME69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]