SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U1NZT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U1NZT1
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily YajQ-like 1.65e-30
Family YajQ-like 0.0006
Further Details:      
 
Domain Number 2 Region: 92-163
Classification Level Classification E-value
Superfamily YajQ-like 1.15e-25
Family YajQ-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U1NZT1
Sequence length 163
Comment (tr|A0A0U1NZT1|A0A0U1NZT1_9BACI) UPF0234 protein BN000_03474 {ECO:0000256|HAMAP-Rule:MF_00632} KW=Complete proteome; Reference proteome OX=1499688 OS=Bacillus sp. LF1. GN=BN000_03474 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSKDSSFDIVSKVDFSEVTNAISQTMKEIGTRYDFKGSKSEVTLDKEELVLVSDDEYKMD
QLKDVLFSKLIKRGVPVKNLDYGKIEKASGGTVRQRAKLAQGIDKENAKKINTIIKNSGV
KVKSQVQDDQVRVTGKSRDDLQKIISLVREADLTIDVQFINYR
Download sequence
Identical sequences A0A0U1NZT1
WP_090636080.1.95526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]