SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U3EJD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U3EJD5
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Barstar-related 0.00000000000000562
Family Barstar-related 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0U3EJD5
Sequence length 89
Comment (tr|A0A0U3EJD5|A0A0U3EJD5_EUBLI) Ribonuclease inhibitor {ECO:0000313|EMBL:ALU14627.1} KW=Complete proteome OX=1736 OS=Eubacterium limosum. GN=ACH52_1847 OC=Eubacterium.
Sequence
MRSITLDGQFMDTIQTAHTYIEKKLEIHDYYGKNLDALWDALTGIATSTRVEIIHFNAAE
AHLGPYAEKLRQVLMDAAVENTFLQVVFL
Download sequence
Identical sequences A0A0U3EJD5
WP_058694543.1.53489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]