SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0QC35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0QC35
Domain Number 1 Region: 65-129
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.62e-17
Family Cell cycle transcription factor e2f-dp 0.00091
Further Details:      
 
Domain Number 2 Region: 140-251
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.00000000000000288
Family E2F dimerization segment 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V0QC35
Sequence length 346
Comment (tr|A0A0V0QC35|A0A0V0QC35_PSEPJ) Uncharacterized protein {ECO:0000313|EMBL:KRW99691.1} KW=Complete proteome; Reference proteome OX=266149 OS=Pseudocohnilembus persalinus (Ciliate). GN=PPERSA_03492 OC=Pseudocohnilembus.
Sequence
MKRKGQQEIISEDSNTNQKKVKLEQENQENNDSQEDDMEVSNDGGDSNNKQSTGQGNPKE
KVKQRQDNSLSVLTKKFVKRIKESDNNTVDLNETVKDLKVQKRRIYDITNVLEGIGYIEK
IHKNKIKWVGGTEDPALENEIKEMELELQSLTDQEKEMDFWIQDLHKGLTDTFIQNSDEQ
KQYTYLTYDDFKKLSKLQNQDKGEALLIITAPKGTTLNVPTIENDQSQEYPHQLQLVSKT
EEIQIFLCSDENYPMNYEKKNKQEENQEEIMGVNEGIEQQQIYQNQDKEQEQNLDKNKNS
TEKNQQKQEQVDEDNSQNQYQQKSEEMDGQENEQQHFDVKEENEKQ
Download sequence
Identical sequences A0A0V0QC35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]