SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V0SJM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0SJM6
Domain Number 1 Region: 13-301
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.68e-71
Family Capz alpha-1 subunit 0.00000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V0SJM6
Sequence length 310
Comment (tr|A0A0V0SJM6|A0A0V0SJM6_9BILA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KRX26952.1} KW=Complete proteome; Reference proteome OX=6336 OS=Trichinella nelsoni. GN=T07_14666 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MPSEVTTLSVNDKRRIEMANEIVSNAPPGEIQEVYNDLRQFLEDDESFTVLSASMFAEHN
KRNFVPVLVEGIEKPVVIFFSSGGSFISFQVIITPFNVLNNGRIYDPRSKQSFEFDHVKL
EAFDRASCPNADVEELESRRLSLQESVDAYISKYFMHGNGSVYSYAEPECDEKKLLICIV
NQQNQPNNFLNGHWQSQFAVQFPKEDELQIDGWIQLKVHYYEDGNVQLFSKKDVNRTIPF
TNEATFANDVVKIVQEEEENFQRNVDQSRRLMSEFNFKGLRRQLPVTRSKIDWSKMVSYR
VATELKPQTP
Download sequence
Identical sequences A0A0V0SJM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]