SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0TIV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0TIV3
Domain Number 1 Region: 21-68
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000759
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 232-280
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000942
Family Elafin-like 0.0022
Further Details:      
 
Domain Number 3 Region: 176-221
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000131
Family Elafin-like 0.0022
Further Details:      
 
Domain Number 4 Region: 124-167
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000942
Family Elafin-like 0.0031
Further Details:      
 
Domain Number 5 Region: 306-348
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000719
Family Elafin-like 0.0041
Further Details:      
 
Domain Number 6 Region: 75-118
Classification Level Classification E-value
Superfamily Elafin-like 0.000000353
Family Elafin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V0TIV3
Sequence length 351
Comment (tr|A0A0V0TIV3|A0A0V0TIV3_9BILA) Whey acidic protein {ECO:0000313|EMBL:KRX38946.1} KW=Complete proteome; Reference proteome OX=144512 OS=Trichinella murrelli. GN=T05_4750 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MVFEFAFTLAIQSIVFSASAWKAGTCPGLPVPIDPDVQYTDRCWNDEDCSGDRKCCMSVV
GKACMLPVETSNELRPGGCPGFFDYGGIKTHHCQRDTDCSQPRKCCDTAKGKRCLLPNEV
ISNQQKPGTCPTFYGIPDEDSFDRCKVDFECPGSRKCCTTRSGKFCLLVDENSSEQIKPG
FCPPVYGIISPRAFNRCNNDADCTSNKKCCDTVSGRTCMAPSGNKFEEETKPIIIIKPGK
CPRFYGAQESQLFDRCIRDSDCNGNRKCCATRTGKECLLPNYDNESDDISDNNNSNMNNN
NNNNNNLRPGVCPPYFGAVNVIKNMCAVDSDCKMPRKCCQTITGKMCLLLS
Download sequence
Identical sequences A0A0V0TIV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]