SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V0X899 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0X899
Domain Number 1 Region: 49-222
Classification Level Classification E-value
Superfamily MIR domain 3.53e-50
Family MIR domain 0.00000876
Further Details:      
 
Domain Number 2 Region: 425-491
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-20
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 294-370
Classification Level Classification E-value
Superfamily PA domain 0.000000000379
Family PA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V0X899
Sequence length 636
Comment (tr|A0A0V0X899|A0A0V0X899_9BILA) Stromal cell-derived factor 2 {ECO:0000313|EMBL:KRX84236.1} KW=Complete proteome; Reference proteome OX=92179 OS=Trichinella sp. T6. GN=T06_761 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MVNQRQLKIQLDARVYFVFEMIRKQTMGIVNTVLIALLLICEVFGEADDYIGCTSVVKLL
NVKIDRRLHSHDVRYGSGSGQQSVTGIADKDDKGSYWVVLAAHDNICQRGQPIACNSVIR
FQHSSTGCLLHSHSAFACPFSGNQEVSCFGKNGIGDEGDNWIVLCDKKYWEIGDEVQFKH
LQTDHYLGMSSRKYDRPIVGQNEVCAFRSDSFPTIWKAVEGIYMKKTGHYRLLYFRSNET
DVEFFDDCTASSATFGLAIVAEEVTMCTLAVEPILACGQLPPAPTHFNSTPFCISGYYAI
ARRGNCSFAKKAFNAQKAGYSGLFIYNDYDEVFPMAGDGIYEKKVTIPALMISRTCGLKL
INDYPSKDGYGVLIRLWWSYNNALKFLIPLVAVIGVSFLILLSVVSFRWFRNQQRLQRRR
LTRRQLKKIPNRKYKKGDEHEMCAICLEDFADGDKMRLLPCGHVYHCACVDPWLLKNRKV
CPVCKRKVTDDSDDSDWDSADEQPAAPSEHSPLFSNLSSSRSSSAGDLQVGNSTFYTNYG
STGCGLCPYSFCRPRAEHDDEVSTVPVSSGGQQQQQQQQHAVASTSSASTGVDNLSFVQD
SISISSVAADPSEPTASTSYPAPSSSSDPPTMTQLP
Download sequence
Identical sequences A0A0V0X899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]