SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1A3L2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1A3L2
Domain Number 1 Region: 265-461
Classification Level Classification E-value
Superfamily MIR domain 1.16e-43
Family MIR domain 0.00000396
Further Details:      
 
Domain Number 2 Region: 465-630
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.84e-36
Family IP3 receptor type 1 binding core, domain 2 0.0000162
Further Details:      
 
Domain Number 3 Region: 1116-1145,1187-1304
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-21
Family IP3 receptor type 1 binding core, domain 2 0.0094
Further Details:      
 
Domain Number 4 Region: 126-195
Classification Level Classification E-value
Superfamily MIR domain 0.0000000392
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V1A3L2
Sequence length 2705
Comment (tr|A0A0V1A3L2|A0A0V1A3L2_9BILA) Inositol 1,4,5-trisphosphate receptor itr-1 {ECO:0000313|EMBL:KRY19414.1} KW=Complete proteome; Reference proteome OX=990121 OS=Trichinella patagoniensis. GN=T12_3220 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
LNCAMSAVDVFSSTFLHIGDEVSLYAEGSDGTNGFLSTLGLVDDRCVVRPAFGTPENPPK
KFRDCIFKICPVRRYAAQKQLWAEERTRQTNGMSSMTLDMMMRLKFNFRVEDAAEKEREQ
NQLEFEKTVGQIVQYGTTLQLLHVKSNKFLTVNKKEPARVDRNAMKVTLDAQGNDGSWFT
VEPFYKLRSLGDNVSKEVVAGDRICLVPYYVAQIPGSQKHQLHVSSLSLAEDSESKEVNC
LNDQTCWQVLLFLEYRENLPDVLKGGDVVRLFHAEQQKFLTQDSRNGVQTVFLRVTKRDQ
ALEATSSKALWEVEVIQQEPHKSGAAKWSSTFRFKHLATDMYLAVLEDEQSKKKPFPMSK
EFKKKSSKSSSMEPTYSLVSVIPASPRDPATLFQLDPTTLTKMDAYIPRQSYIRLKHVQT
KNWVHSTTTRCDPEKGDESVMLKLGCSNWKEDKEAFAILSVIPGEVRDLDFANDACKALA
DFLQRIRHGLNVMKEKGMIMELLAELIYFVTNAKNHLEDPLKIKPNKVNRNRQKLLREQK
VLAQIFDLLRAPFESRKDQRPLFENPSVLSKPGNESFKRMFQLMYTVLRFSQQSYRRNQV
YIAERFIDIQHQIGHGLMAEDTITAVLHDNAKLLETHVEKTHIEKFIELVRQNREGRFLD
YLTLLCVCKNEANKKIQELICLLVLNDANRDILLETRMFGDQVFIGWLNDESEELEKLAY
ETMNSPEAERIVNYYKHQLDLFSHMCLDRQFLAIDPPANKHLLNLSQELPISVILRCMVN
ERLPYDLRANFARLMLHLHVITDLQEVMPVRYARLWKEIPETVSVEKYTNEEIYSFNQKQ
RRLFARSRFTGLLTYVEEYLRHVKTAKFSHKAQNVFTLEIVNLAHALVKFGFYSLPELLV
LAQDLLDILDNCSLDMERVSNGAVVGAVVPNRTEENMKMEVSSFIESEKQPSDHEDGKTV
NLKTKLTIVEILQYVLNVRLDYRITYLLSLIKKEYASSDTGDVGFYEDLDDLKITQFAHE
VFYSKSHCVEVDVEKEDFNCRLELGRENGKQLLRILLQIMLSDYPPLISLGLSVFYQSFN
QRNELVQALKQLQLLVSQMDVQNYQQVHRDLVLMKNLVEKSELWVYSAKTGSQKRSLFPI
TNDKKSTEDEPLQRYDNDLVELINVEEEKKNMMKLFKELNCKYPMSSEHCRKLLSDILNN
WVKLCYADERRPDGRNQQLLRNMRVYEVVIEFLSIPFDKKIDSEMPKLFDLAHQFLCGFC
NDNEENQRLLHQRLSLNTDASKCDYLAIEEPRDIETLCAIFRGNRELCANVSDQLIQHVV
HLIESKGRNAIFLQFLQTLIPEERTISLTQEKISQVISTSSEDVCLFYTDSAGFEAMMSL
MKQSVDLSDLCNPLRYHIELVRLLALCTVGKNVTTELQCASHIPLEHIVRVITDEQCFYE
IKEVYLQFLLHCYIDTDADMKDMYCDDCMAQILANVLDDVEQLYERGPSINGSVERYICL
TVTKLLICFFEQPCAQCFSDPKHENGIFGRLLEALGRLQSIDWLRRQNAIYKSNLINCVE
TMCKFAIIYLFSFPCFYWIGAHDQRLAVTVDMIMRKEGKSSKWTKLKKAKYFVTQAAHMT
RKGHDFNNIVDCFHEIVCRMEDLFGPMARAETMVAVDVLHYPDLTFYDTQSNMKRYSDGE
FVTKLIKHCRLLAYDKNEQLCIKLLDTIRSMIPAEQDLDTSTMNSRKDLLLQYLGIHGPG
RSGKAKSFKDDDQERWTTMLKKILPQNITSVQCSLNAAGASKLVIDLIVHCSSENIFIAA
VELGKTLLEGGNRVVQNSFLECLTSGGVGENFFRVFNEKMQRAQNKLRSSILSRRDRIGG
SRMTSRSFMSGSSQTSAVGQAHDEAIRKIQDQLKLWSDDDWVGGSESSDIRTERCWREQD
KVDADFLLPAEVTIMEPILRLLQLLCENHNPALQNFLRCQENRTNYNMVTETLMFLDTIC
GSTSGSLGLLHEINEHNVSLVNQALISLTEYCQGPCHENQNAIAMHESNGLDIIISLVLN
EIMPLAEKNIQLALEIKSNASKLLLAILESRNDCDNAERILRNMARMAGGAEQLVSAITD
VFKLPEISFNHSGYAEKIASQFDTPKIVFETKTDINGNPVENDGYCEVSPSEVGHNIYIL
AHQLSKYYPKLNSMLKPSNARDEISRSALQFYTDHTAHIEVVRSDRSLELIIFPVPHVCK
FLTEETKERVFLKTERDLQGSKVPEFFANFDTLYNEIVWQQKLRDKPWLYKCSRSVPIWM
RMSFIFAMILNFLVALFYPFDSAFGAAINTEISGFYLLCLLATTTYTFTAPTWTAVAVTS
TFVASSCVSLFGVTVASYLFGLLQIANNIVHTVGIIGSYGPMKLTLASFLSNSNVVYNMF
YLLLCLCGLFVHEFFYCFLLFDIVLHEETLCNVIRSVTRNWRSIALTGILAVILVYTFSM
VGFVLFSNDFWIEVEPNDQTCAQSENCTETTNVPGEPVKVPFCESLRTCILAVLRWGLSS
GGGIGDVLRKPHPQEPLFYMRILYDLSFYFILIVIVLNLIFGVIIDTFADLRNEKQENEE
IIRNTCFICGLERSHFENKPVSFDEHIKNDHNIWNYFYFYVLLNTKSSTEFTGPESYVYD
MIKEGNVDWFPRMRTMKLAIQEGDSEQTEVKILQRMICERQEEISNLAARIDELKQMVLK
LSRSK
Download sequence
Identical sequences A0A0V1A3L2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]