SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1BW02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1BW02
Domain Number 1 Region: 40-213
Classification Level Classification E-value
Superfamily MIR domain 6.67e-50
Family MIR domain 0.00000811
Further Details:      
 
Domain Number 2 Region: 454-520
Classification Level Classification E-value
Superfamily RING/U-box 2.07e-20
Family RING finger domain, C3HC4 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1BW02
Sequence length 684
Comment (tr|A0A0V1BW02|A0A0V1BW02_TRISP) Stromal cell-derived factor 2 {ECO:0000313|EMBL:KRY41184.1} KW=Complete proteome OX=6334 OS=Trichinella spiralis (Trichina worm). GN=T01_1992 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MVNQRQLKIQLDARVQTMGIVNTVLIALLLICEVFGEADDYIGCTSVVKLLNVKIDRRLH
SHDVRYGSGSGQQSVTGIADKDDKGSYWVVLAANDNICQRGQPIACNSVIRFQHSSTGCL
LHSHSAFACPFSGNQEVSCFGKNGIGDEGDNWIVLCDKKYWEKGDEVQFKHLQTDHYLGM
SSRKYDRPIVGQNEVCAFRSDSFPTTWKAVEGIYMKKTGHYRLLYVFFFCSFGRLALQPL
FSMFFGPMKQTWNFSTIAQPLVQHSALPLLPKKLQCVSMCTLAVEPILACGQLPPAPTHF
NSTPFCISGYYAIARRGNCSFAKKVKKIVLILFSSKVEQLIVSQICRHSMRKKLATQVCL
FTMTTMRCFPWLAMVQLLFVFILRPNILLINDYPSKDGYGVLIRLWWSYNNALKFLIPLV
AVIGVSFLILLSVVSFRWFRNQQRLQRRRLTRRQLKKIPNRKYKKGDEHEMCAICLEDFA
DGDKMRLLPCGHVYHCACVDPWLLKNRKVCPVCKRKVTDDSDDSDWDSADEQPAAPSEHS
PLFSNLSSSRSSSAGDLQVGNSTFYTNYGSTGCGLCPYSFCRPRAEHDNGMLKQPAKKPS
LFHINCSAEETTVPVSSGGQQQQQQQQHAVASTSSASTGVDNLSFVQDSTSISSLAADPS
EPTASTSYPAPSSSSDPPATTQLP
Download sequence
Identical sequences A0A0V1BW02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]