SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1C2N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1C2N1
Domain Number 1 Region: 261-457
Classification Level Classification E-value
Superfamily MIR domain 1.27e-43
Family MIR domain 0.00000396
Further Details:      
 
Domain Number 2 Region: 461-626
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.27e-36
Family IP3 receptor type 1 binding core, domain 2 0.0000162
Further Details:      
 
Domain Number 3 Region: 1112-1141,1183-1300
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-21
Family IP3 receptor type 1 binding core, domain 2 0.0094
Further Details:      
 
Domain Number 4 Region: 122-191
Classification Level Classification E-value
Superfamily MIR domain 0.0000000405
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1C2N1
Sequence length 2730
Comment (tr|A0A0V1C2N1|A0A0V1C2N1_TRISP) Inositol 1,4,5-trisphosphate receptor itr-1 {ECO:0000313|EMBL:KRY43472.1} KW=Complete proteome OX=6334 OS=Trichinella spiralis (Trichina worm). GN=T01_11779 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MSAVDVFSSTFLHIGDEVSLYAEGSDGTNGFLSTLGLVDDRCVVRPAFGTPENPPKKFRD
CIFKICPVRRYAAQKQLWAEERTRQTNGMSSMTLDMMMRLKFNFRVEDAAEKEREQNQLE
FEKTVGQIVQYGTTLQLLHVKSNKFLTVNKKEPARVDRNAMKVTLDAQGNDGSWFTVEPF
YKLRSLGDNVSKEVVAGDRICLVPYYVAQIPGSQKHQLHVSSLSLAEDSESKEVNCLNDQ
TCWQVLLFLEYRENLPDVLKGGDVVRLFHAEQQKFLTQDSRNGVQTVFLRVTKRDQALEA
TSSKALWEVEVIQQEPHKSGAAKWSSTFRFKHLATDMYLAVLEDEQSKKKPFPMSKEFKK
KSSKSSSIEPTYSLVSVIPASPRDPATLFQLDPTTLTKMDAYIPRQSYIRLKHVQTKNWV
HSTTTRCDPEKGDESVMLKLGCSNWKEDKEAFAILSVMPGEVRDLDFANDACKALADFLQ
RIRHGLNVMKEKGMIMELLTELIYFVTNAKNHLEDPLKIKPNKVNRNRQKLLREQKVLAQ
IFDLLRAPFESRKDQRPLFENPSVLSKPGNESFKRMFQLMYTVLRFSQQSYRRNQVYIAE
RFIDIQHQIGHGLMAEDTITAVLHDNAKLLETHVEKTHIEKFIELVRQNREGRFLDYLTL
LCVCKNEANKKIQELICLLVLNDANRDILLETRMFGDQVFIGWLNDESEELEKLAYETMN
SPEAERIVNYYKHQLDLFSHMCLDRQFLAIDPPANKHLLNLSQELPISVILRCMVNERLP
YDLRANFARLMLHLHVITDLQEVMPVRYARLWKEIPETVSVEKYTNEEIYSFNQKQRRLF
ARSRFTGLLTYVEEYLRHVKTAKFSHKAQNVFTLEIVNLAHALVKFGFYSLPELLVLAQD
LLDILDNCSLDMEGVSNGAVVGAVVPNRTEENMKMEVSSFIESEKQPSDHEDGKTVNLKT
KLTIVEILQYVLNVRLDYRITYLLSLIKKEYASSDTGDVGFYEDLDDLKITQFAHEVFYS
KSHCVEVDVEKEDFNCRLELGRENGKQLLRILLQLMLSDYPPLISLGLSVFYQSFNQRNE
LVQALKQLQLLVSQMDVQNYQQVHRDLLLMKNLVEKSELWVYSAKTGSQKRSLFPITNDK
KSTEDEPLQRYDNDLVELINVEEEKKNMMKLFKELNCKYPMSSEHCRKLLSDILNNWVKL
CYADERRPDGRNQQLLRNMRVYEVVIEFLSIPFDKKIDSEMPKLFDLAHQFLCGFCNDNE
ENQRLLHQRLSLNTDASKCDYLAIEEPRDIETLCAIFRGNRELCANVSDQLIQHVVHLIE
SKGRNAIFLQFLQTLIPEERTISLTQEKISQVISTSSEDVCLFYTDSAGFEAMMSLMKQS
VDLSDLCNPLRYHIELVRLLALCTVGKNVTTELQCASHIPLEHIVRVITDEQCFYEIKEV
YLQFLLHCYIDTDADMKDMYCDDCMAQILANVLDDVEQVLLLLLYERGPSINGSVERYIC
LTVTKLLICFFEQPCAQCFSDPKHENGIFGRLLEALGRLQSIDWLRRQNAIYKSNLINCV
ETMCKFAIIYLFSFPCFCWIGAHDQRLAVTVDMIMRKEGKSSKWTKLKKAKYFVTQAAHM
TRKGHDFHNIVDCFHEIVCRMEDLFGPMARAETMVAVDVLHYPDLTFYDTQSNMKRYSDG
EFVTKLIKHCRLLAYDKNEQLCIKLLDTIRSMIPAEQDLDTSTMNSRKDLLLQYLGIHGP
GRSGKAKSFKDDDQERWTTMLKKILPQNITSVQCSLNAAGASKLVIDLIVHCSSENIFIA
AVELGKTLLEGGNRVVQNSFLECLTSGGVGENFFRVFNEKMQRAQNKLRSSILSRRDRIG
GSRMTSRSFMSGSSQTSAVGQAHDEAIRKIQDQLKLWSDDDWVGGSESSDIRTERCWREQ
DKVDADFLLPAEVTIMEPILRLLQLLCENHNPALQNFLRCQENRTNYNMVTETLMFLDTI
CGSTSGSLGLLHEINEHNVSLVNQALISLTEYCQGPCHENQNAIAMHESNGLDIIISLVL
NEIMPLAEKNIQLALEIKSNASKLLLAILESRNDCDNAERILRNMARMAGGAEQLVSAIT
DVFKLPEISFNHSGYAEKIASQFDTPKIVFETKTDINGNPVEENDGYCEVSPSEVGHNIY
ILAHQLSKYYPKLNSMLKPSNARDEISRSALQFYTDHTAHIEVVRSDRSLELIIFPVPHV
CKFLTEETKERVFLKTERDLQGSKVPEFFANFDTLYNEIVWQQKLRDKPWLYKCSRSVPI
WMRMSFIFAMILNFLVALFYPFDSAFGAAINTEISGFYLLCLLATTTYTFTAPTWTAVAV
TSTFVASSCVSLFGVTVASYLFGLLQIANNIVHTVGIIGSYGPMKLTLASFLSNSNVVYN
MFYLLLCLCGLFVHEFFYCFLVRMFAVLEYLSSSKTAPLFLLFKLFDIVLHEETLCNVIR
SVTRNWRSIALTGILAVILVYTFSMVGFVLFSNDFWIEVEPNDQTCAQSENCTETTNVPG
EPVKVPFCESLRTCILAVLRWGLSSGGGIGDVLRKPHPQEPLFYMRILYDLSFYFILIVI
VLNLIFGVIIDTFADLRNEKQENEEIIRNTCFICGLERSHFENKPVSFDEHIKNDHNIWN
YFYFYVLLNTKSSTEFTGPESYVYEMIKEGNVDWFPRMRTMKLAIQEGDSEQTEVKILQR
MICERQEEISNLAARIDELKQMVLKLSRSK
Download sequence
Identical sequences A0A0V1C2N1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]