SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1CIS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1CIS9
Domain Number 1 Region: 41-70,187-356
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.56e-58
Family G proteins 0.0000000282
Further Details:      
 
Domain Number 2 Region: 70-189
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.15e-41
Family Transducin (alpha subunit), insertion domain 0.0000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V1CIS9
Sequence length 362
Comment (tr|A0A0V1CIS9|A0A0V1CIS9_TRIBR) Guanine nucleotide-binding protein G(Q) subunit alpha {ECO:0000313|EMBL:KRY49137.1} KW=Complete proteome; Reference proteome OX=45882 OS=Trichinella britovi (Parasitic roundworm). GN=T03_18092 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
LDGLMKEFVMTCCSSEEAREQRRINREIEKQLQRDKRNARRELKLLLLGTGESGKSTFIK
QMKIIHGSGYSDEDKRGLIRVVFQNIFMAMQAMIRAMDTLKVPYGDPSNEEKAVIIRAID
YESVTTFEEPYVSYIRDLWNDKGILEVYDRRREYQLTDSAKYYLSDIDRISQPNYLPTEQ
DILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQ
VLVECDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMTSHLVDYFPEYDG
PPRDAIAAREFILKTFVDLNPDADKIIYSHFTCATDTENIRFVFAAVRDTILQHNLKEYN
LV
Download sequence
Identical sequences A0A0V0WEY0 A0A0V1AZ94 A0A0V1CIS9 A0A0V1HI09 A0A0V1IHH7 A0A0V1LFY6 A0A0V1MZT8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]