SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1D9V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1D9V9
Domain Number 1 Region: 13-287
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.23e-73
Family Capz alpha-1 subunit 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1D9V9
Sequence length 296
Comment (tr|A0A0V1D9V9|A0A0V1D9V9_TRIBR) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KRY58298.1} KW=Complete proteome; Reference proteome OX=45882 OS=Trichinella britovi (Parasitic roundworm). GN=T03_7095 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MPSEVTTLSVNDKRRIEMANELVSNAPPGEIQEVYNDLRQFLEDDESFTVLSASMFAEHN
KRNFVPVLVEGIEKPVVIITPFNVLNNGRIYDPRSKQSFEFDHVKLEAFDRASCPNADVE
ELESRRLSLQESVDAYISKYFMHGNGSVYSYAEPECDEKKLLICIVNQQNQPNNFLNGHW
QSQFAVQFPKEDELQIDGWIQLKVHYYEDGNVQLFSKKDVNRTIPFTNEATFANDVVKIV
QEEEENFQRNVDQSRRLMSEFNFKGLRRQLPVTRSKIDWSKMVSYRVATELKPQTP
Download sequence
Identical sequences A0A0V0TXP0 A0A0V0WB54 A0A0V1ABK1 A0A0V1D9V9 A0A0V1LPL4 A0A0V1NWF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]