SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1DI79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1DI79
Domain Number 1 Region: 29-202
Classification Level Classification E-value
Superfamily MIR domain 9.42e-50
Family MIR domain 0.00000823
Further Details:      
 
Domain Number 2 Region: 443-509
Classification Level Classification E-value
Superfamily RING/U-box 2.03e-20
Family RING finger domain, C3HC4 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1DI79
Sequence length 671
Comment (tr|A0A0V1DI79|A0A0V1DI79_TRIBR) Stromal cell-derived factor 2 {ECO:0000313|EMBL:KRY61153.1} KW=Complete proteome; Reference proteome OX=45882 OS=Trichinella britovi (Parasitic roundworm). GN=T03_2053 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MIRKQTMGIVNTVLIALLLICEVFGETDDYIGCTSVVKLLNVKIDRRLHSHDVRYGSGSG
QQSVTGIADKDDKGSYWVVLAAHDNICQRGQPIACNSVIRFQHSSTGCLLHSHSAFACPF
SGNQEVSCFGKNGIGDEGDNWIVLCDKKYWEKGDEVQFKHLQTDHYLGMSSRKYDRPIVG
QNEVCAFRSDSFPTIWKAVEGIYMKKTGHYRLLYVFFFCSFGPLALQPLFSMFFGPMKQT
WNFSTIAQPLVQHSALPLLPKKLQCVSMCTLAVEPILACGQLPPAPTHFNSTPFCISGYY
AIARRGNCSFAKKVKKIVLILFSSKVEQLIVSQICRHSMRKKLATQVCLFTMTTMRCFPW
LAMVQLLFAFILRPNILLINDYPSKDGYGVLIRLWWSYNNALKFLIPLVAVIGVSFLILL
SVVSFRWFRNQQRLQRRRLTRRQLKKIPNRKYKKGDEHEMCAICLEDFADGDKMRLLPCG
HVYHCACVDPWLLKNRKVCPVCKRKVTDDSDDSDWDSADEQPAAPSEHSPLFSNLSSSRS
SSAGDLQVGNSTFYTNYGSTGCGLCPYSFCRPRAEHDNGMLKQRAKKPSLFHINCSAEVS
TVPVSSGGQQQQQQHAVASTSSASTGVDNLSFVQDSISISSVAADPSEPTASTSYPAPSS
SSDPPTTTQLP
Download sequence
Identical sequences A0A0V1DI79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]