SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1E3Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1E3Y5
Domain Number 1 Region: 119-165
Classification Level Classification E-value
Superfamily Elafin-like 0.00000051
Family Elafin-like 0.0046
Further Details:      
 
Domain Number 2 Region: 39-65
Classification Level Classification E-value
Superfamily Elafin-like 0.00000889
Family Elafin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1E3Y5
Sequence length 191
Comment (tr|A0A0V1E3Y5|A0A0V1E3Y5_TRIPS) Uncharacterized protein {ECO:0000313|EMBL:KRY68066.1} KW=Complete proteome; Reference proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4A_4032 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MNKYCFALLIFLIQWRDGISVQKIAFKSDQLAKNKSAVALSSCTSDGDCPEQHKCCTRVE
STVCLPVDDDVSNLNEKHSKQAAVVDRVCPDGEKPLKNCYTVRCPYGYYCFYGLCCKHSK
AGQCPAAIVGGGEPAGPSCDNDMECPWILKCCVINGNSRCVFPFNYVGGTVGISWPMMKL
RQSNRAKRIKL
Download sequence
Identical sequences A0A0V1E3Y5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]