SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1EWT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1EWT3
Domain Number 1 Region: 19-224
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.15e-50
Family Capz beta-1 subunit 0.000000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V1EWT3
Sequence length 242
Comment (tr|A0A0V1EWT3|A0A0V1EWT3_TRIPS) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KRY78132.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4A_12266 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MVINFENYEFLRRKMTQNRLDFALDLMRRLPPQKCEGFLGCLIELVPDMCDGSVPIDRLR
KIEIDANYAIEQYKDMYFDSGVSSVYAWDLDHSFACAILIKKDGDAKKMANGSWDSIHII
EVQEKSSGRSAHYKLTSTIMLWLLTESSGRPRIDLSGSLTRQSESDAPLVDSYSHVINMG
KMIEEMENKMRGSLNTIYFGKTYDIISCLRSMETKQERDEQAQLQQELARAIHCRQDSFK
KE
Download sequence
Identical sequences A0A0V1EWT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]