SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1FVQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1FVQ4
Domain Number 1 Region: 23-192
Classification Level Classification E-value
Superfamily MIR domain 1.16e-49
Family MIR domain 0.00000992
Further Details:      
 
Domain Number 2 Region: 384-449
Classification Level Classification E-value
Superfamily RING/U-box 2.36e-20
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 252-328
Classification Level Classification E-value
Superfamily PA domain 0.000000000327
Family PA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V1FVQ4
Sequence length 589
Comment (tr|A0A0V1FVQ4|A0A0V1FVQ4_TRIPS) E3 ubiquitin-protein ligase RNF13 {ECO:0000313|EMBL:KRY90041.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4D_13573 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MGIVNTILIALLLICEVLGDADDYIGCTSVVKLLNVKIDRRLHSHDVRYGSGSGQQSVTG
IADKDDKGSYWVVLAAHDNICQRGQPIACNSVIRLQHSSTGCLLHSHSAFACPFSGNQEV
SCFGKNGIGDEGDNWIVLCDKKYWEKGDEVHFKHLQTDHYLGMSSRKYDRPIVGQNEVCA
FRSDSFPTTWKAFRSNETDVEFFDDCTASSATFGLAIVAEEVTMCTLAVEPILACGQLAP
APTHFNSTPFCISGYYAIARRGNCSFAKKAFNAQKAGYSGLFIYNDYDEVFPMAGDGIYE
KKVTIPALMISRTCGLKLINDYPSKDGYGVLIRLWWSYNNALKFLIPLVAVIGVSFLILL
SVVSFRWFRNQQRLQRRRLTRRQLKKIPNRKFKKGDEHEMCAICLEDFADGDKMRLLPCG
HVYHCACVDPWLLKNRKVCPVCKRKVTDDGDDSDWDSADEQPAAPSEHSPLFSNLSSSRS
SSAGDLQVGNSTFYANYGSTGCGLCPYSLCRPRAEHENVSSGGQQQQQQQQHAVASNSSA
STGVDNLSFVQDSTSTSSVAADPSEPTAGTGYPAPSSSSDVSPTTTQLP
Download sequence
Identical sequences A0A0V1FVQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]