SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1GT70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1GT70
Domain Number 1 Region: 38-105
Classification Level Classification E-value
Superfamily POZ domain 2.62e-17
Family BTB/POZ domain 0.00047
Further Details:      
 
Domain Number 2 Region: 115-173
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000000549
Family Skp1 dimerisation domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V1GT70
Sequence length 192
Comment (tr|A0A0V1GT70|A0A0V1GT70_9BILA) E3 ubiquitin ligase complex SCF subunit sconC {ECO:0000313|EMBL:KRZ01346.1} KW=Complete proteome; Reference proteome OX=268475 OS=Trichinella zimbabwensis. GN=T11_4686 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MLHLLLAIYKLPKPKFLKKSTINFENIFTNVLSMSEEFELVSNDGVAFKADWLVVKQSNT
LKTMLESFGIDKNSENLESIPLPKINSKVLGKILQYCNHHRNDPPYDETKPFLPDFFTNW
DAEFFNVDTTFLILLAEAANYLDIKSLSDALSYILISIMKGRSRDFVLRALNAASNNIFK
RQSEAMEQTLFF
Download sequence
Identical sequences A0A0V1GT70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]