SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1HG40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1HG40
Domain Number 1 Region: 261-472
Classification Level Classification E-value
Superfamily MIR domain 2.35e-39
Family MIR domain 0.00000603
Further Details:      
 
Domain Number 2 Region: 476-641
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.84e-36
Family IP3 receptor type 1 binding core, domain 2 0.0000162
Further Details:      
 
Domain Number 3 Region: 1127-1156,1198-1315
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-21
Family IP3 receptor type 1 binding core, domain 2 0.0091
Further Details:      
 
Domain Number 4 Region: 122-190
Classification Level Classification E-value
Superfamily MIR domain 0.0000000523
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1HG40
Sequence length 2701
Comment (tr|A0A0V1HG40|A0A0V1HG40_9BILA) Inositol 1,4,5-trisphosphate receptor itr-1 {ECO:0000313|EMBL:KRZ09742.1} KW=Complete proteome; Reference proteome OX=268475 OS=Trichinella zimbabwensis. GN=T11_16869 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
LCDEATMSAVDVFSSTFLHIGDEVSLYAEGSDGTNGFLSTLGLVDDRCVVRPAFGTPENP
PKKFRDCIFKICPVRRYAAQKQLWAEERTRQTNGMSSMTLDMMMRLKDAAEKEREQNQLE
FEKTVGQIVQYGTTLQLLHVKSNKFLTVNKKEPARVDRNAMKVTLDAQGNDGSWFTVEPF
YKLRSLGDNVSEEVVAGDRICLVPYYVAQIPGSQKHQLHVSSLSLAEDSESKEVNCLNDQ
TCWQVLLFLEYRENLPDVLKGGDVVRLFHAEQQKFLTQDSRNGVQTVFLRVTKRDQALEA
TSSKALWEVEVIQQEPHKSGAAKWNSTFRFKHLATDMYLAVLEDEHSKKKPFPMSKEFKK
KSSKSSSMEATYSLVSVIPASPRDPATLFQLDPTTLTKMDAYIPRHFIFYFFTNFHKIIL
QSYIRLKHVQTKNWVHSTTTRCDPEKGDESVMLKLGCSNWKEDKEAFAILSVMPGEVRDL
DFANDACKALADFLQRIRHGLNVMKEKGMIMELLAELIYFVTNAKNHLEDPLKIKPNKVN
RNRQKLLREQKVLAQIFDLLRAPFESRKDQRPLFENPSVLSKPGNESFKRMFQLMYTVLR
FSQQSYRRNQVYIAERFIDIQHQIGHGLMAEDTITAVLHDNAKLLETHVEKTHIEKFIEL
VRQNREGRFLDYLTLLCVCKNEANKKIQELICLLVLNDANRDILLETRMFGDQVFIGWLN
DESEELEKLAYETMNSPEAERIVNYYKHQLDLFSHMCLDRQFLAIDPPANKHLLNLSQEL
PISVILRCMVNERLPYDLRANFARLMLHLHVITDLQEVMPVRYARLWKEIPEIVSVEKYT
NEEIYSFNQKQRRLFARSRFTGLLTYVEEYLRHVKTAKFSHKAQNVFTLEIVNLAHALVK
FGFYSLPELLILAQDLLDILDNCSLDMERVSNGAVVGAVVPNRTEENMKMEVSSFIESEK
QPSDHEDGKTVNLKTKLTIVEILQYVLNVRLDYRITYLLSLIKKEYASSDTGDVGFYEDL
DDLKITQFAHEVFYSKSHCVEVNVEKEDFNCRLELGRENGKQLLRILLQLMLSDYPPLIS
LGLSVFYQSFNQRNELIQALKQLQLLVSQMDVQNYQQVHRDLLLMKNLVEKSELWVYSAK
TGSQKRSLFPTANDKKSTEDEPSQRYDNDLVELINVEEEKKNMIKLFKELNCKYPMSSEH
CRKLLSDILNNWVKLCYADERRPDGRNQQLLRNMRVYEVVIEFLSIPFDKKIDSEMPKLF
DLAHQFLCGFCNDNEENQRLLHQRLSLNSDASKCDYLAIEEPRDIETLCAIFRGNRELCA
NVSDQLIQHVVHLIESKGRNAIFLQFLQTLIPEERTISLTQEKISQVISTSSEDVCLFYT
DSAGFEAMMSLMKQSVDLSDLCNPLRYHIELVRLLALCTVGKNVTTELQCASHIPLEHIV
RVITDEQCFYEIKEVYLQFLLHCYIDTDADMKDMYCDDCMAQILANILDDVEQLYERGPS
INGSVERYICLTVTKLLICFFEQPCAQCFSDPKHENGTFGRLLEALGRLQSIDWLRRQNA
IYKSNLMNCVETMCKFAHDQRLAVTVDMIMRKEGKSSKWAKLKKAKYFVTQAAHMTRKGH
DFNNIVDCFQEIVCRMEDLFGPMARAETMVAVDVLHYPDLTFYDTHSHMKRYSDGEFVTK
LIKHCRLLAYDKNEQLCIKLLDTIRSMIPAEQDLDTSTMNSRKDLLLQYLGIHGPGRSGK
AKSFKDDDQERWATMLKKILPQNITNVQCSLNAAGASKLVIDLIVHCSSEMIFIAAVELG
KTLLEGGNRVVQNSFLECLTSGGVGENFFRVFNEKMQRAQNKLRSSILSRRDRIGGSRMT
SRSFMSGSSQTSAVGQSHDEAIRKIQDQLKLWSDDDWLGGSESNDIRTERCWREQDKVDA
DFLLPAEVTIMEPILRLLQLLCENHNPALQNFLRCQENRTNYNMVTETLMFLDTICGSTS
GSLGLLHEINEHNVSLVNQALISLTEYCQGPCHENQNAIAMHESNGLDIIISLVLNEIMP
LAEKNIQLALEIKSNASKLLLAILESRNDCDNAERILRNMARMAGGAEQLVSAITDVFKL
PEISFNHSAYAENIALQFDTPKIVFETKTDINGNPIENDGYCEVSPSEVGHNIYILAHQL
SKYYPKLNSMLKPSNARDEISRSALQFYTDHTAHIEVVRSDRSLELIIFPVPHVCKFLTE
ETKERVFLKTERDLQGSKVPEFFANFDTLYNEIVWQQKLRDKPWLYKCSRSVPIWMRMSF
IFAMILNFLVALFYPFDSAFGAAINTEISGFYLLCLLATTTYTFTAPTWTAVAVTSAFVA
SSCVSLFGVTVASYLFGLLQIANNIVHTVGIIGSYGPMKLTVASFLSNSNVVYNMFYLLL
CLCGLFVHEFFYCFLLFDIVLHEETLCNVIRSVTRNWRSIALTGILAVILVYTFSMVGFV
LFSNDFWIEVEPNDQTCTESENCTATTNVPGEAVKVPFCESLRTCILAVLRWGLSSGGGI
GDVLRKPHPQEPLFYMRILYDLSFYFILIVIVLNLIFGVIIDTFADLRNEKQENEEIIRN
TCFICGLERSHFENKPVSFDEHIKNDHNIWNYFYFYVLLNTKSSTEFTGPESYVYDMIKE
GNVDWFPRMRTMKLAIQEGDGEQTEVKMLQRMICERQEEISNLAARIDELKQMVLKLSRS
K
Download sequence
Identical sequences A0A0V1HG40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]