SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1IG56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1IG56
Domain Number 1 Region: 13-309
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.27e-68
Family Capz alpha-1 subunit 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1IG56
Sequence length 318
Comment (tr|A0A0V1IG56|A0A0V1IG56_TRIPS) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KRZ21492.1} KW=Complete proteome; Reference proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4A_3010 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MPSEVTTLSVNDSRRIEMANELVSNAPPGEIQEVYDDLRQFLENDETFTVLSASMFAEHN
KRNFVPVLVEGIEKPVVVFFCFCSGSFISFHVASLAFQVIITPFNVLNNGRIYDPRSKQS
FELDHIKLEAFDRASCPNADVEELESRRLSLQESVDAYISKYFMHGNGSVFSYAEPECDE
KKLLICIVNQQNQPNNFLNGHWQSQFAVQFPKEDELQIDGWIQLKVHYYEDGNVQLFSKK
DVNRTIPFTNEATFANDVVKVVQEEEENFQRNVDQSRRLMSEFNFKGLRRQLPVTRSKID
WSKMVSYRVATELKPQTP
Download sequence
Identical sequences A0A0V1IG56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]