SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1IPZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1IPZ2
Domain Number 1 Region: 23-196
Classification Level Classification E-value
Superfamily MIR domain 1.44e-50
Family MIR domain 0.00000786
Further Details:      
 
Domain Number 2 Region: 452-517
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-20
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 320-396
Classification Level Classification E-value
Superfamily PA domain 0.000000000366
Family PA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V1IPZ2
Sequence length 663
Comment (tr|A0A0V1IPZ2|A0A0V1IPZ2_TRIPS) Stromal cell-derived factor 2 {ECO:0000313|EMBL:KRZ24692.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4B_8442 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MGIVNTILIALLLICEVLGDADDYIGCTSVVKLLNVKIDRRLHSHDVRYGSGSGQQSVTG
IADKDDKGSYWVVLAAHDNICQRGQPIACNSVIRLQHSSTGCLLHSHSAFACPFSGNQEV
SCFGKNGIGDEGDNWIVLCDKKYWEKGDEVHFKHLQTDHYLGMSSRKYDRPIVGQNEVCA
FRSDSFPTTWKAVEGIYMKKIFCFTYVKRNKKLTTRWKSLEKRRCVRSVQLEEEEKVCFH
HDVQLVIIDFFIAATFILYVFRSNETDVEFFDDCTASSATFGLAIVAEEVTMCTLAVEPI
LACGQLAPAPTHFNSTPFCISGYYAIARRGNCSFAKKAFNAQKAGYSGLFIYNDYDEVFP
MAGDGIYEKKVTIPALMISQTCGLKLINDYPSKDGYGVLIRLWWSYNNALKFLIPLVAVI
GVSFLILLSVVSFRWFRNQQRLQRRRLTRRQLKKIPNRKFKKGDEHEMCAICLEDFADGD
KMRLLPCGHVYHCACVDPWLLKNRKVCPVCKRKVTDDGDDSDWDSADEQPAAPSEHSPLF
SNLSSSRSSSAGDLQVGNSTFYANYGSTGCGLCPYSLCRPRAEHENEETVSVSSGGQQQQ
QQQQQHAVASNSSASTGVDNLSFVQDSTSTSSVAADPSEPTAGTGYPAPSSSSDVSPTTT
QLP
Download sequence
Identical sequences A0A0V1IPZ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]