SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1IZL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1IZL4
Domain Number 1 Region: 283-492
Classification Level Classification E-value
Superfamily MIR domain 3.01e-39
Family MIR domain 0.00000369
Further Details:      
 
Domain Number 2 Region: 496-661
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.97e-36
Family IP3 receptor type 1 binding core, domain 2 0.0000162
Further Details:      
 
Domain Number 3 Region: 1148-1177,1219-1336
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.14e-21
Family IP3 receptor type 1 binding core, domain 2 0.0091
Further Details:      
 
Domain Number 4 Region: 148-227
Classification Level Classification E-value
Superfamily MIR domain 0.00000000327
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V1IZL4
Sequence length 2748
Comment (tr|A0A0V1IZL4|A0A0V1IZL4_TRIPS) Inositol 1,4,5-trisphosphate receptor itr-1 {ECO:0000313|EMBL:KRZ27733.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4B_8951 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
LSEKSESEVCEKEKDRRTFELCDETAMSAVDVFSSTFLHIGDEVSLYAEGSDGTNGFLST
LGLVDDRCVVRPAFGTPENPPKKFRDCIFKICPVRRYAAQKQLWAEERTRQTSGMSSMTL
DMMMRLKFNFRVEDAAEKEREQNQLEFEKTVGQIVQYGTTLQLLHVKSNKFLTVNKKEPA
RVDRNAMKVTLDAQGNDGSWFTVEPFYKLRSLGDNVVAGDRICLVPYYVAQIPGSQKHQL
HVSSLSLAEDSESKEVNCLNDQTCWQVLLFLEYRENLPDVLKGGDVVRLFHAEQQKFLTQ
DSRNGVQTVFLRVTKRDQALEATSSKALWEVEVIQQEPHKSGAAKWNSTFRFKHLATDMY
LAVLEDEHSKKKPFPMSKEFKKKSSKSSSMEATYSLVSMIPASPRDPATLFQLDPTTLTK
MDAYIPRHFIFYFFKNFQKKQSYIRLKHIQTKNWVHSTTTRCDPEKGDESVMLKLGCSNW
KEDKEAFAILSVMPGEVRDLDFANDACKALADFLQRIRHGLNVMKEKGMIMELLAELIYF
VTNAKNHLEDPLKIKPNKVNRNRQKLLREQKVLAQIFDLLRAPFESRKDQRPLFENPSVL
SKPGNESFKRMFQLMYTVLRFSQQSYRRNQVYIAERFIDIQHQIGHGLMAEDTITAVLHD
NAKLLETHVEKTHIEKFIELVRQNREGRFLDYLTLLCVCKNEANKKIQELICLLVLNDAN
RDILLETRMFGDQVFIGWLNDESEELEKLAYETMNSPEAERVVNYYKHQLDLFSHMCLDR
QFLAIDPPANKHLLNLSQELPISVILRCMVNERLPYDLRANFARLMLHLHVITDLQEVMP
VRYARLWKEIPEIVSVEKYTNEEIYSFNQKQRRLFARNRFTGLLTYVEEYLRHVKTAKFS
HKAQNVFTLEIVNLAHALVKFGFYSLPELLVLAQDLLDILDNCSLDMESVSNGAVVGRAV
VPNRTEENIKMEVSSFIESEKQPSDHEDGKTVNLKTKLTIVEILQYVLNVRLDYRITYLL
SLIKKEYASSDTGDVGFYEDLDDLKITQFAHEVFYSKSHCVEVDVEKEDFNCRLELGREN
GKQLLRILLQLMLSDYPPLISLGLSVFYQSFNQRNELIQALKQLQLLVSQMDVQNYQQVH
RDLLLMKNLVEKSELWVYSAKTGSQKRSLFPMANDKKSTEDEPSQRYDNDLVELMNVEEE
KKNMIKLFKELNCKYPMSSEHCRKLLSDILNNWVKLCYADERRPDGRNQQLLRNMRVYEV
VIEFLSIPFDKKIDSEMPKLFDLAHQFLCGFCNDNEENQRLLHQRLSLNSDASKCDYLAI
EEPRDIETLCAIFRGNRELCANVSDQLIQHVVHLIESKGRNAIFLQFLQTLIPEERTISL
TQEKISQVISTSSEDVCLFYTDSAGFEAMMSLMKQSVDLSDLCNPLRYHIELVRLLALCT
VGKNVTTELQCASHIPLEHIVRVITDEQCFYEIKEVYLQFLLHCYIDTDADMKDMYCDDC
MAQILANILDDVEQLYERGPSINGSVERYICLTVTKLLICFFEQPCAQCFSDPKHENGIF
GRLLEALGRLQSIDWLRRQNAIYKSNLINCVETMCKFAHDQRLAVTVDMIMRKEGKSSKW
AKLKKAKYFVTQAAHMTRKGHDFNNIVDCFQEIVCRMEDLFGPMARAETMVAVDVLHYPD
LTFYDTQSHMKRYSDGEFVTKLIKHCRLLAYDKNEQLCIKLLDTIRSMIPAEQDLDTSTM
NSRKDLLLQYLGIHGPGRSGKAKSFKDDDQERWTAMLKKILPQNITNVQCSLNAAGASKL
VIDLIVHCSSENIFIAAVELGKTLLEGGNRVVQNSFLECLTSDGVGENFFRVFNEKMQRA
QNKLRSSILSRRDRIGGSRMTSRKSSFMSGSSQTSAVGQAHDEAIRKIQDQLKLWSDDDW
LGGSESNDIRTERCWREQDKVDTDFLLPAEVTIMEPILRLLQLLCENHNPALQNFLRCQE
NRTNYNMVTETLMFLDTICGSTSGSLGLLHEINEHNVSLVNQALISLTEYCQGPCHENQN
AIAMHESNGLDIIISLVLNEIMPLAEKNIQLALEIKSNASKLLLAILESRNDCDNAERIL
RNMARMAGGAEQLVSAITDVFKLPEMSFNHSAYAENIALQFDTPKIVFETKTDINGNPIE
NDGYCEVSPSEVGHNIYILAHQLSKYYPKLNSMLKPSNARDEISRSALQFYHDHTAHIEV
VRSDRSLELIIFPVPHVCKFLTEETKERVFLKTERDLQGSKVPEFFANFDILYNEIVWQQ
KLRDKPWLYKCSRSVPIWMRMSFIFAMILNFLVALFYPFDSAFGGWSLVHRFIFFLNSTS
NAPLSHFIAAINTEISGFYLLCLLATTTYTFTAPTWTAVAVTSAFVAFSCVSLFGVTVAS
YLFGLLQIANNIVHTVGIIGSYGPMKLTVASFLSNSNVVYNMFYLLLCLCGLFLHEFFYC
FLLFDIVLHEETLCNVIRSVTRNWRSIALTGILAVILVYTFSMVGFVLFSNDFWIEVEPN
DQTCAESQNCTETTNVPGEAVKVPFCESLRTCILAVLRWGLSSGGGIGDVLRKPHPQEPL
FYMRILYDLSFYFILIVIVLNLIFGVIIDTFADLRNEKQENEEIIRNTCFICGLERSHFE
NKPVSFDEHIKNDHNIWNYFYFYVLLNTKSSTEFTGPESYVYEMIKEGNVDWFPRMRTMK
LAIQEGDGEQTEVKMLQRMICERQEEISNLAARIDELKQMVLKLSRSK
Download sequence
Identical sequences A0A0V1IZL4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]