SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V1P5S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1P5S0
Domain Number 1 Region: 251-447
Classification Level Classification E-value
Superfamily MIR domain 1.44e-43
Family MIR domain 0.00000396
Further Details:      
 
Domain Number 2 Region: 451-616
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.84e-36
Family IP3 receptor type 1 binding core, domain 2 0.0000162
Further Details:      
 
Domain Number 3 Region: 1102-1131,1173-1290
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-21
Family IP3 receptor type 1 binding core, domain 2 0.0094
Further Details:      
 
Domain Number 4 Region: 116-195
Classification Level Classification E-value
Superfamily MIR domain 0.00000000327
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V1P5S0
Sequence length 2703
Comment (tr|A0A0V1P5S0|A0A0V1P5S0_9BILA) Inositol 1,4,5-trisphosphate receptor itr-1 {ECO:0000313|EMBL:KRZ91474.1} KW=Complete proteome; Reference proteome OX=92180 OS=Trichinella sp. T8. GN=T08_7295 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MSAVDVFSSTFLHIGDEVSLYAEGSDGTNGFLSTLGLVDDRCVVRPAFGTPENPPKKFRD
CIFKICPVRRYAAQKQLWAEERTRQTNGMSSMTLDMMMRLKDAAEKEREQNQLEFEKTVG
QIVQYGTTLQLLHVKSNKFLTVNKKEPARVDRNAMKVTLDAQGNDGSWFTVEPFYKLRSL
GDNVVAGDRICLVPYYVAQIPGSQKHQLHVSSLSLAEDSESKEVNCLNDQTCWQVLLFLE
YRENLPDVLKGGDVVRLFHAEQQKFLTQDSRNGVQTVFLRVTKRDQALEATSSKALWEVE
VIQQEPHKSGAAKWSSTFRFKHLATDMYLAVLEDEQSKKKPFPISKEFKKKSSKSSSMEP
TYSLVSVIPASPRDPATLFQLDPTTLTKMDAYIPRQSYIRLKHVQTKNWVHSTTTRCDPE
KGDESVMLKLGCSNWKEDKEAFAILSVMPGEVRDLDFANDACKALADFLQRIRHGLNVMK
EKGMIMELLAELIYFVTNAKNHLEDPLKIKPNKVNRNRQKLLREQKVLAQIFDLLRAPFE
SRKDQRPLFENPSVLSKPGNESFKRMFQLMYTVLRFSQQSYRRNQVYIAERFIDIQHQIG
HGLMAEDTITAVLHDNAKLLETHVEKTHIEKFIELVRQNREGRFLDYLTLLCVCKNEANK
KIQELICLLVLNDANRDILLETRMFGDQVFIGWLNDESEELEKLAYETMNSPEAERIVNY
YKHQLDLFSHMCLDRQFLAIDPPANKHLLNLSQELPISVILRCMVNERLPYDLRANFARL
MLHLHVITDLQEVMPVRYARLWKEIPETVSVEKYTNEEIYSFNQKQRRLFARSRFTGLLT
YVEEYLRHVKTAKFSHKAQNVFTLEIVNLAHALVKFGFYSLPELLVLAQDLLDILDNCSL
DMERVSNGAVVGAVVPNRTEENMKMEVSSFIESEKQPSDHEDGKTVNLKTKLTIVEILQY
VLNVRLDYRITYLLSLIKKEYASSDTGDVGFYEDLDDLKITQFAHEVFYSKSHCVEVDVE
KEDFNCRLELGRENGKQLLRILLQIMLSDYPPLISLGLSVFYQSFNQRNELVQALKQLQL
LVSQMDVQNYQQVHRDLVLMKNLVEKSELWVYSAKTGSQKRSLFPITNDKKSTEDEPLQR
FDNDLVELINVEEEKKNMMKLFKELNCKYPMSSEHCRKLLSDILNNWVKLCYADERRPDG
RNQQLLRNMRVYEVVIEFLSIPFDKKIDSEMPKLFDLAHQFLCGFCNDNEENQRLLHQRL
SLNTDASKCDYLAIEEPRDIETLCAIFRGNRELCANVSDQLIQHVVHLIESKGRNAIFLQ
FLQTLIPEERTISLTQEKISQVISTSSEDVCLFYTDSAGFEAMMSLMKQSVDLSDLCNPL
RYHIELVRLLALCTVGKNVTTELQCASHIPLEHIVRVITDEQCFYEIKEVYLQFLLHCYI
DTDADMKDMYCDDCMAQILANVLDDVEQVLLLLLYERGPSINGSVERYICLTVTKLLICF
FEQPCAQCFSDPKHENGIFGRLLEALGRLQSIDWLRRQNAIYKSNLINCVETMCKFGNGK
KSLAIIYLFSFPCFYWIGAHDQRLAVTVDMIMRKEGKSSKWTKLKKAKYFVTQAAHMTRK
GHDFNNIVDCFHEIVCRMEDLFGPMARAETMVAVDILHYPDLTFYDTQSNMKRYSDGEFV
TKLIKHCRLLAYDKNEQLCIKLLDTIRSMIPAEQDLDTSTMNSRKDLLLQYLGIHGPGRS
GKAKSFKDDDQERWTTMLKKILPQNITSVQCSLNAAGASKLVIDLIVHCSSENIFIAAVE
LGKTLLEGGNRVVQNSFLECLTSGGVGENFFRVFNEKMQRAQNKLRSSILSRRDRIGGSR
MTSRSFMSGSSQTSAVGQAHDEAIRKIQDQLKLWSDDDWVGGSESSDIRTERCWREQDKV
DADFLLPAEVTIMEPILRLLQLLCENHNPALQNFLRCQENRTNYNMVTETLMFLDTICGS
TSGSLGLLHEINEHNVSLVNQALISLTEYCQGPCHENQNAIAMHESNGLDIIISLVLNEI
MPLAEKNIQLALEIKSNASKLLLAILESRNDCDNAERILRNMARMAGGAEQLVSAITDVF
KLPEISFNHSGYAEKIALQFDTPKIVFETKTDINGNPVENDGYCEVSPSEVGHNIYILAH
QLSKYYPKLNSMLKPSNARDEISRSALQFYTDHTAHIEVVRSDRSLELIIFPVPHVCKFL
TEETKERVFLKTERDLQGSKVPEFFANFDTLYNEIVWQQKLRDKPWLYKCSRSVPIWMRM
SFIFAMILNFLVALFYPFDSAFGAAINTEISGFYLLCLLATTTYTFTAPTWTAVAVTSTF
VASSCVSLFGVTVASYLFGLLQIANNIVHTVGIIGSYGPMKLTLASFLSNSNVVYNMFYL
LLCLCGLFVHEFFYCFLLFDIVLHEETLCNVIRSVTRNWRSIALTGILAVILVYTFSMVG
FVLFSNDFWIEVEPNDQTCAQSENCTETTNVPGEPVKVPFCESLRTCILAVLRWGLSSGG
GIGDVLRKPHPQEPLFYMRILYDLSFYFILIVIVLNLIFGVIIDTFADLRNEKQENEEII
RNTCFICGLERSHFENKPVSFDEHIKNDHNIWNYFYFYVLLNTKSSTEFTGPESYVYDMI
KEGNVDWFPRMRTMKLAIQEGDSEQTEVKILQRMICERQEEISNLAARIDELKQMVLKLS
RSK
Download sequence
Identical sequences A0A0V1P5S0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]