SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0W0C9X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0C9X4
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-78
Family Capz alpha-1 subunit 0.0000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W0C9X4
Sequence length 262
Comment (tr|A0A0W0C9X4|A0A0W0C9X4_CANGB) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KTA96447.1} KW=Complete proteome OX=5478 OS=Candida glabrata (Yeast) (Torulopsis glabrata). GN=AO440_003371 OC=Nakaseomyces/Candida clade.
Sequence
MSNDFDTIIKNIIKDSPAGELEEVYQDLITIAGENSKETIIDAIAEYNVENSIPIDVDGK
DVIISKYNKQGTKFVDPVNGIQFSVDHLHQKGLDVEEYSADIDADQKKAITDLGNYLSTN
FPGRATFAVLPLEEQSKTAIIIVSTKYNPSNFWNGHWKSEYVYDKTEGKLSGTIDIDVHY
YEDGNVKFHSSKLVEETNIKDPVASIKELEHKFEQDLQESFTDLNEKQFKSLRRRLPITR
ARVNWGKAIGNYRLGRDAAQGK
Download sequence
Identical sequences A0A0W0C9X4 Q6FN48
XP_448346.1.27851 gnl|GLV|CAGL0K02783g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]