SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0FAN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0FAN9
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 1.7e-38
Family Transthyretin (synonym: prealbumin) 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W0FAN9
Sequence length 125
Comment (tr|A0A0W0FAN9|A0A0W0FAN9_9AGAR) 5-hydroxyisourate hydrolase {ECO:0000256|RuleBase:RU361270} KW=Complete proteome; Reference proteome OX=221103 OS=Moniliophthora roreri. GN=WG66_14023 OC=Moniliophthora.
Sequence
MSKSPITCHVLDSSIGRPAEGVAIQLQFFEPAKAEGDPDLFTPFAKGVTNSDGRCLDLLL
PHEAKEMLHPGLYKIIFRTKEYFDRSNRESFYPWVEITFDLKNPNEHYHIPLLISPFSFT
TYRGS
Download sequence
Identical sequences A0A0W0FAN9 V2XDI5
XP_007849744.1.35326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]