SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0QWS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0QWS9
Domain Number 1 Region: 19-126
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 1.15e-36
Family Transthyretin (synonym: prealbumin) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W0QWS9
Sequence length 126
Comment (tr|A0A0W0QWS9|A0A0W0QWS9_PSEFL) 5-hydroxyisourate hydrolase {ECO:0000256|RuleBase:RU361270} KW=Complete proteome; Reference proteome OX=1230466 OS=Pseudomonas fluorescens ABAC62. GN=AO262_14545 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTLAALSLSGLCNLALADGNPLSVHVLNLENGLPSAGVSVTLEQQVGDHWQSLSEGVTNQ
QGRIAELFPANRSMTPGQYRVVFKTGDYYKKANRETFFPQVPVIFQVKQAGQHYHIPLLL
SPYGFS
Download sequence
Identical sequences A0A0W0QWS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]