SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W1A668 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W1A668
Domain Number 1 Region: 113-203
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.000000628
Family V-type ATPase subunit E 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W1A668
Sequence length 215
Comment (tr|A0A0W1A668|A0A0W1A668_9GAMM) Flagellar assembly protein H {ECO:0000313|EMBL:KTD76777.1} KW=Complete proteome; Reference proteome OX=45076 OS=Legionella worsleiensis. GN=Lwor_2002 OC=Legionellaceae; Legionella.
Sequence
MAKIIHQALISDETIIIGLKPVLSKQNDLQESEIKPTAREADWEELREQVYQQGFTAGVT
EGKLRIEQEMADARKTLENVLSAIPQAIERNRLDLHHEIAEIVLLIAQEYFIEQHQKPDA
LHQQINQILKHLNTKQNIELQLHPDEIKTIHQLNIKLETAHLNGIRIKAVPDLAPGGCII
KTEHGVFDISLETRLERLKEILMQLKQGRPNAVAD
Download sequence
Identical sequences A0A0W1A668
WP_058493771.1.39882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]