SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W1LFQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W1LFQ4
Domain Number 1 Region: 62-92
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000706
Family H-NS histone-like proteins 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W1LFQ4
Sequence length 100
Comment (tr|A0A0W1LFQ4|A0A0W1LFQ4_9GAMM) Histone family protein nucleoid-structuring protein H-NS {ECO:0000313|EMBL:KTF17895.1} KW=Complete proteome; Reference proteome OX=1348393 OS=Pseudoalteromonas sp. H105. GN=ATS75_00275 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MKEIRSFIKTASLSELEKAQTLINDALVKFTEQQQAKQEVLDLLKEKGLTLEDLQDIAGD
KRTKVLPKYRIEHEGKVVEWTGRGKRPKAFQGVDLTTCLV
Download sequence
Identical sequences A0A0W1LFQ4
WP_058558436.1.10792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]