SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8DI21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0W8DI21
Domain Number - Region: 40-107
Classification Level Classification E-value
Superfamily NAP-like 0.0575
Family NAP-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DI21
Sequence length 118
Comment (tr|A0A0W8DI21|A0A0W8DI21_PHYNI) Uncharacterized protein {ECO:0000313|EMBL:KUF95977.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10004230 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MEKPTSNFNPSQENLICLYPSKRCDNPRGIKRNGKLHNFCEFHRNKANYNQRRLEHKRKY
QQEVRPLVDSRPKTLLQGIVDPNAIASPPTTLEPDDIWILQELLDVENASNENAGHAN
Download sequence
Identical sequences A0A0W8DI21 W2Q241
XP_008908126.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]