SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0W8DL28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8DL28
Domain Number 1 Region: 97-291
Classification Level Classification E-value
Superfamily MIR domain 3.27e-45
Family MIR domain 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DL28
Sequence length 295
Comment (tr|A0A0W8DL28|A0A0W8DL28_PHYNI) Stromal cell-derived factor 2 {ECO:0000313|EMBL:KUF97065.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10014949 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MRLLLLALLSALPSIAADSATHCVKWRATSNCDPHGVREPHNDAACSKRIASGLSGYCEC
EGRRRVREVECDHHEFTCEEACAQDSSADLSYPQGFEHVTCGSSIKLVHEPSRYRLHSHE
IAYGSGSGQQSVTAHMARNDVNSYWLVKEGDGAPVCDVGKPIECGATIRLEHMQTRRNLH
SHMFKAPLSSQNLEVSAFGVAGEGDRMDSWVVECQENQQCSAEGQCEDDGLWKRGELVRL
RHRATNHLLTTSSRSRFDDSNCPRCPINGQQEVSGSSTRDENTLWFAGEGIYVTE
Download sequence
Identical sequences A0A0W8DL28 V9ECT1 W2MMW9 W2PNX2
XP_008912333.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]