SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X3NTB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0X3NTB6
Domain Number 1 Region: 157-223
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0000000000392
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0X3NTB6
Sequence length 231
Comment (tr|A0A0X3NTB6|A0A0X3NTB6_SCHSO) RILP-like protein 1 {ECO:0000313|EMBL:JAP40727.1} OX=70667 OS=Schistocephalus solidus (Tapeworm). GN=TR117405 OC=Diphyllobothriidea; Diphyllobothriidae; Schistocephalus.
Sequence
MLRLKEVIDKQRIEIRALKRQLAQSSIDLDAIQQQANRLAKLNAVLRRKHGVSKRQAAQL
AEDKSELETRLLAKEQLIQEMRDHVYRNSKNGSEQNALIDMATSTTFSLSASLISDSASS
PTNEQVSQMSEEKLVRLLNTEGKMILDVPNSSRPRFTVDELRNALIERNELKSRIVEVEE
ELSVYNRAGDQDPPVQGPIDREPDEKLYFDQHRSSSGIQKFFKTLIDRLKN
Download sequence
Identical sequences A0A0X3NTB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]