SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X3T487 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0X3T487
Domain Number 1 Region: 155-235
Classification Level Classification E-value
Superfamily Barstar-related 0.00000000301
Family Barstar-related 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0X3T487
Sequence length 245
Comment (tr|A0A0X3T487|A0A0X3T487_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KUJ70622.1} KW=Complete proteome; Reference proteome OX=67257 OS=Streptomyces albus subsp. albus. GN=ACZ90_02285 OC=Streptomyces.
Sequence
MYCLVEDETQREILTATDIRGFFIDPSIGESDFITMIGSSLRPEKFPLLCEDVELQVRDV
QGKEIGGYYIGRAEVTDAKDNISTPGGTDLAVSFGYAEPYPYAGEIWRTWTHGPPTEPGM
WKNLPAEAHESWIHVVQKAWFRSGHQAIVYGDADTYEIAGAELANIDSFYCALGEAVNGP
GGYLGSNPSALTDCLFNSAGKHRKLFRLVWRDFDVSRRNIDEEELDWALTAMRDHGVEVE
YPSAD
Download sequence
Identical sequences A0A0X3T487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]