SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0X8PSF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0X8PSF5
Domain Number - Region: 9-47
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.068
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0X8PSF5
Sequence length 238
Comment (tr|A0A0X8PSF5|A0A0X8PSF5_9ENTE) Uncharacterized protein {ECO:0000313|EMBL:AMG51251.1} KW=Complete proteome OX=2060306 OS=Enterococcus sp. FDAARGOS_163. GN=AL523_16510 OC=Enterococcus.
Sequence
MERSKIDPGRFFSGQKAATKGTLKNQYHYYRQQNAHQAFNSDFQRNFQQDFPNFATWLKL
QQQTPQKNQTATFSHWLLVGFFGLLTAASFSQQLLFLLFVFVIAALVKGPGMILWGIVYS
FLVSLFPPLGIVLSGLFFLLTLRQLTKNVTFVLTALYFYGYPFVITALQHFTNWDPQWLW
VGSIGFALISGHFVLQQNYPFASSKSLAWAIISVPYDCVMALIPVKHKARFKRLVKIK
Download sequence
Identical sequences A0A0X8PSF5 A0A242CM89 A0A242E5D2 F0EK35 S4CJ73
WP_005234809.1.15981 WP_005234809.1.31162 WP_005234809.1.4926 WP_005234809.1.93087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]