SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Z8DPR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Z8DPR6
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000591
Family SinR domain-like 0.077
Further Details:      
 
Weak hits

Sequence:  A0A0Z8DPR6
Domain Number - Region: 99-183
Classification Level Classification E-value
Superfamily Hypothetical protein YqbG 0.00575
Family Hypothetical protein YqbG 0.011
Further Details:      
 
Domain Number - Region: 203-276
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0471
Family Capz alpha-1 subunit 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Z8DPR6
Sequence length 299
Comment (tr|A0A0Z8DPR6|A0A0Z8DPR6_STRSU) Transcriptional regulator {ECO:0000313|EMBL:CYX05261.1} KW=Complete proteome OX=1307 OS=Streptococcus suis. GN=ERS132502_02010 OC=Streptococcus.
Sequence
MNDKEFGQRVRQLRESASMTREQFCDDELELSVRQLTRIEAGTSKPTFSKIQYIATRLGM
GLYELMPDYVSLPERYSKLKFDVLRTPTYGNEELVEKRDAIMTEIYDDYYDELPEEEKIA
IDAIQSRIDTLESGTAGFGKEILEDYFEQIFRKRKYELNDLLIVRLHLEYVRLSSCDSEI
FRQFLKIIEHLHEQINIINSNDLFVLRDTLLSSVNILGSKKYYEPIPKIFDSVDKIIQST
QDFQKKPIVSVLKWKYALFVDKDRDEAEKHYLDAVLFAKLIENRELEQKIEEDWRVDNQ
Download sequence
Identical sequences A0A0Z8DPR6 U5UBY6
gi|556587654|ref|YP_008755208.1| WP_023369017.1.101447 WP_023369017.1.11918 WP_023369017.1.17388 WP_023369017.1.19521 WP_023369017.1.21348 WP_023369017.1.21994 WP_023369017.1.25841 WP_023369017.1.29542 WP_023369017.1.32380 WP_023369017.1.36180 WP_023369017.1.37914 WP_023369017.1.44134 WP_023369017.1.47108 WP_023369017.1.47119 WP_023369017.1.51052 WP_023369017.1.58933 WP_023369017.1.5894 WP_023369017.1.61415 WP_023369017.1.61715 WP_023369017.1.6272 WP_023369017.1.63018 WP_023369017.1.63174 WP_023369017.1.69056 WP_023369017.1.70484 WP_023369017.1.72611 WP_023369017.1.7342 WP_023369017.1.78138 WP_023369017.1.88746 WP_023369017.1.88882 WP_023369017.1.91387 WP_023369017.1.98406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]