SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A100YPJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A100YPJ1
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily Barstar-related 1.31e-16
Family Barstar-related 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A100YPJ1
Sequence length 100
Comment (tr|A0A100YPJ1|A0A100YPJ1_9FIRM) Barstar (Barnase inhibitor) {ECO:0000313|EMBL:KUH50717.1} KW=Complete proteome; Reference proteome OX=29466 OS=Veillonella parvula. GN=AT982_02370 OC=Veillonella.
Sequence
MARQVFTIDGRKFSNIKGFYQEVEAVFTDGLGWHIGDNLDAFNDVLRGGFGRHEYGEPIH
IRWISYDKSIRNLGREIMAEIEEIILDTDNSGHDCTLEKL
Download sequence
Identical sequences A0A100YPJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]