SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101EXQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101EXQ8
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.53e-45
Family HEPN domain 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A101EXQ8
Sequence length 132
Comment (tr|A0A101EXQ8|A0A101EXQ8_9BACT) HEPN domain protein {ECO:0000313|EMBL:KUK26749.1} KW=Complete proteome; Reference proteome OX=1635286 OS=Acetothermia bacterium 64_32. GN=XD60_1016 OC=Bacteria; Candidatus Acetothermia.
Sequence
MAKMLNRKLDWLRQAKRDLDHARRSLELGDYEWACFAAQQAAEKALKALYQSLGGEARGH
SVRGLLERLPPRLSPGRELEAAARELDKHYIPTRYPNSYAEGAPFEYYSEEEARRAISHA
EKIIGFCEDNMV
Download sequence
Identical sequences A0A101EXQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]