SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101VE79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101VE79
Domain Number 1 Region: 27-192
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.06e-23
Family Hypothetical protein TM0269 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A101VE79
Sequence length 227
Comment (tr|A0A101VE79|A0A101VE79_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KUO53127.1} KW=Complete proteome; Reference proteome OX=1734395 OS=Desulfitibacter sp. BRH_c19. GN=APF76_03550 OC=Desulfitibacter.
Sequence
MGFTIIENIKFDLDFEELLTRLRIKEGTSYVKRLKQLVQEAENVANLKVLYKLAYIEDKG
DDTVVIDGIKFSSRVLRVNLEKVNRVFAYVATCGYELEKWSEGFTDMLEVFWVDAIKELG
LRSARNALTKHLKDKYEMGKIAEMNPGSLGDWPISQQKELFQLLDDPKELIGVELKSSFL
MTPIKSVSGIYFPTETNYKNCMLCPKEECPGRKAPYDEKLYNEKYAK
Download sequence
Identical sequences A0A101VE79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]