SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101WXA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101WXA0
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.92e-36
Family HEPN domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A101WXA0
Sequence length 131
Comment (tr|A0A101WXA0|A0A101WXA0_9CREN) DNA-binding protein {ECO:0000313|EMBL:KUO80829.1} KW=Complete proteome; Reference proteome OX=1714253 OS=Vulcanisaeta sp. JCHS_4. GN=AT718_10390 OC=Thermoproteaceae; Vulcanisaeta.
Sequence
MREEAEHWFKEALNKLELAKRLLELDYLNYTCFHSHQAVEKALKALIIQKLRVIPPKTHN
LIELAERLREGGLPTNEVMDDLKDLNPHYLVSRYPDAANGVPSEVYSRRVAESCVRMATR
VIEWIRRLLTP
Download sequence
Identical sequences A0A101WXA0
2013935935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]