SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A102DQA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A102DQA9
Domain Number 1 Region: 4-236
Classification Level Classification E-value
Superfamily ThiG-like 1.96e-82
Family ThiG-like 0.0000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A102DQA9
Sequence length 254
Comment (tr|A0A102DQA9|A0A102DQA9_9FLAO) Thiazole synthase {ECO:0000256|HAMAP-Rule:MF_00443, ECO:0000256|SAAS:SAAS00958550} KW=Complete proteome OX=1756148 OS=Elizabethkingia genomosp. 2. GN=ATB95_13605 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MNDLQIADRIYTSRLFLGTGKFGNMSQMTEAVKASESELVTMALKRIDHQSDSDDLLTAL
QLPDVHLLPNTSGARNAKEAVLAAQLAREALETNWLKLEIHPDPRYLLPDPIETLKATEE
LAKLGFIVMPYIHADPVLCKRLENAGTAVVMPLGAPIGSNKGLRTLDFLEIIIEQSNVPV
VVDAGIGAPSDAAKAMEMGADAVLVNTAIAVAGDPVQMAIAFKEAVIAGRRGYEAQLGAV
HSGAVASSPLTSFL
Download sequence
Identical sequences A0A102DQA9
WP_059345337.1.40236 WP_059345337.1.70044 WP_059345337.1.72590 WP_059345337.1.97548 WP_059345337.1.98752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]