SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A109D7U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A109D7U8
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 5.62e-20
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A109D7U8
Sequence length 207
Comment (tr|A0A109D7U8|A0A109D7U8_9VIBR) Sigma-E factor negative regulatory protein {ECO:0000256|PIRNR:PIRNR016938} KW=Complete proteome OX=1194427 OS=Vibrio toranzoniae. GN=APQ14_11210 OC=Vibrionaceae; Vibrio.
Sequence
MADKEKLSALMDGETIDKALIVDLESDQESMNTWQSYHLIGDVMRGDAPETKDWNIADSV
AAALEAEPAHSAMPNLHQVNVEPTVAPIEEQPKPQQAKRQLPAWLQQFGQVAVAACVSLA
VVLGVQQYGGNDPAAPEQLPVLQTIPFAGSAEPVSLTRDSVSKPVSEANLQEQRKRVHAL
LEDYELQLRLNGDASSMEDAHLESDIE
Download sequence
Identical sequences A0A109D7U8
WP_060468625.1.39040 WP_060468625.1.805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]