SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A109UWS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A109UWS0
Domain Number 1 Region: 2-255
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.2e-67
Family Capz alpha-1 subunit 0.0000666
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A109UWS0
Sequence length 262
Comment (tr|A0A109UWS0|A0A109UWS0_9SACH) HBR007Cp {ECO:0000313|EMBL:AMD18908.1} OX=45286 OS=Eremothecium sinecaudum. GN=AW171_hschr2435 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Eremothecium.
Sequence
MSKFNEIIKNLMFDAAPSEVLSVYKSLLDLTDGKNKASIIDVLQEYNIAHRIPITIDGTP
SVISEYNKQGSKFYDPIKKKLFSVDYVEGNAMDIEPYDVDVPEEQMKVFEDIQQYLKSTF
PAESACSVLSTGEEDNLAIIIVSMKFSPANFWSGYWKSEYIYNPRSKELKGKIDVSAHYY
ENGNVKFKFSESINEEAVKDIVTSIKRIETTFDTKLNVGFRKLNETQFSKLRRRLPVTRS
KINWGKAIGNYRLGKDATKGSD
Download sequence
Identical sequences A0A109UWS0
XP_017985904.1.1318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]